General Information

  • ID:  hor006549
  • Uniprot ID:  P51923
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Sparus aurata (Gilthead sea bream)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sparus (genus), Sparidae (family), Spariformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIRMMGTGGVVSLPEEASAQTQERLRPYNVIKDDSSPFD
  • Length:  46
  • Propeptide:  MEASSRVTVQVLLLALVVQVTLSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERLRPYNVIKDDSSPFDRKKRFPNK
  • Signal peptide:  MEASSRVTVQVLLLALVVQVTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51923-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006549_AF2.pdbhor006549_ESM.pdb

Physical Information

Mass: 578535 Formula: C212H343N59O75S2
Absent amino acids: CHW Common amino acids: ES
pI: 4.08 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 13
Hydrophobicity: -44.57 Boman Index: -9546
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 74.13
Instability Index: 5358.7 Extinction Coefficient cystines: 1490
Absorbance 280nm: 33.11

Literature

  • PubMed ID:  9843645
  • Title:  Levels of the native forms of GnRH in the pituitary of the gilthead seabream, Sparus aurata, at several characteristic stages of the gonadal cycle.